DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and hnrnpd

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001103930.1 Gene:hnrnpd / 560522 ZFINID:ZDB-GENE-070424-97 Length:314 Species:Danio rerio


Alignment Length:261 Identity:78/261 - (29%)
Similarity:120/261 - (45%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GDCKGDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGF 77
            |:.:|....|.|.|  |...|:|:||||..||.:.|:.:|::||.|.|..:..||::..||||||
Zfish    37 GEAEGSKIDASKNE--EDEGKMFVGGLSWDTTKKDLKDYFTKFGEVVDCTLKLDPLTGRSRGFGF 99

  Fly    78 VTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGG 142
            |.:.:.:|||.|...:.|.::.|:::.|.|   :..|....|                |:||:||
Zfish   100 VLFKEAESVEKVITQKEHKLNGKVIDPKKA---KAMKTKEPV----------------KKIFVGG 145

  Fly   143 LKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVE 207
            |.....|..:||||..:|.|.|::|.|:.:|.::|.|.|:.|.:....:|.:....|.|..:..|
Zfish   146 LSPDTPEEKIREYFDAYGEVESIELPMENKTNKRRGFCFITFKEEEPVKKIMEKMYHNIGLSKCE 210

  Fly   208 VKRSTQKADRRFRFPIFSSVRAGYI--------PPQP-------------ATADSYNYNNPNYNP 251
            ||.:..|  .:::.......|.||.        |.|.             ....:|.|||..|..
Zfish   211 VKVAMSK--EQYQQQQQWGGRGGYTSRGRGRGGPNQNWNQGYGNYWNQGYGNYGNYGYNNQGYGG 273

  Fly   252 Y 252
            |
Zfish   274 Y 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 31/76 (41%)
RRM2_hnRNPA_like 137..209 CDD:240774 24/71 (34%)
hnrnpdNP_001103930.1 CBFNT 3..54 CDD:285369 6/18 (33%)
RRM1_hnRNPD_like 56..129 CDD:241019 29/72 (40%)
RRM2_hnRNPD 140..214 CDD:241027 26/73 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.