DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and hnrnpa2b1

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001192271.1 Gene:hnrnpa2b1 / 549680 XenbaseID:XB-GENE-490993 Length:350 Species:Xenopus tropicalis


Alignment Length:192 Identity:73/192 - (38%)
Similarity:118/192 - (61%) Gaps:13/192 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIV 89
            |...|..||:||||||.:||.::||.::.|:|.:.|.||:|||.|..||||||||:.....|:..
 Frog     2 EREKEQFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMDEVDAS 66

  Fly    90 QRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVRE 154
            ..|||||||.::||.|.|:.|::..:.|...:|             |::|:||:||..:|:.:||
 Frog    67 MAARPHTIDGRVVEPKRAVAREESAKPGAHVTV-------------KKLFVGGIKEDTEEHHLRE 118

  Fly   155 YFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKAD 216
            ||.::|.:.|::::.|:::|::|.|||:.|.|....:|.:..:.|.|.....||:::..|.:
 Frog   119 YFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 40/76 (53%)
RRM2_hnRNPA_like 137..209 CDD:240774 24/71 (34%)
hnrnpa2b1NP_001192271.1 RRM1_hnRNPA2B1 7..87 CDD:241206 41/79 (52%)
RRM2_hnRNPA2B1 100..179 CDD:241025 26/78 (33%)
HnRNPA1 294..319 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.