DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and Hnrnpa1l2-ps2

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001159443.1 Gene:Hnrnpa1l2-ps2 / 545091 MGIID:3645633 Length:320 Species:Mus musculus


Alignment Length:188 Identity:75/188 - (39%)
Similarity:114/188 - (60%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRAR 93
            |.|||:||||||.|||.::||..|.|:|.:.|.||:|||.:..|||||||||...:.|:....||
Mouse    11 EQLRKLFIGGLSFQTTDKSLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNAR 75

  Fly    94 PHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQ 158
            ||.:|.|:||.|.|:.|||.:|.|             ..:..|:||:||:||..:|:.:|:||.|
Mouse    76 PHKVDGKVVEPKRAISRQDSQRPG-------------AHLIVKKIFVGGIKEDTEEHHLRDYFEQ 127

  Fly   159 FGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKAD 216
            :|.:..::::.||.:|::|.|.|:.|.|..|.:..:..:.|.:.....||:::..|.:
Mouse   128 YGKIEVIEIMTDRGSGKKRDFAFVTFDDHDSVDTIVIQKYHNVNGHNCEVRKALSKQE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 41/76 (54%)
RRM2_hnRNPA_like 137..209 CDD:240774 23/71 (32%)
Hnrnpa1l2-ps2NP_001159443.1 RRM_SF 12..92 CDD:302621 43/79 (54%)
RRM_SF 105..181 CDD:302621 25/75 (33%)
HnRNPA1 257..>281 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D560101at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.