DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and Rbm34

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_766350.2 Gene:Rbm34 / 52202 MGIID:1098653 Length:442 Species:Mus musculus


Alignment Length:263 Identity:51/263 - (19%)
Similarity:98/263 - (37%) Gaps:53/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GDGKTAI----KEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGF 77
            |..:|.|    :||..::.|.:|:|.|......:.|:.||.::|.| ::|..|..:...    |.
Mouse   170 GGQRTKIPVNPEEERLKNERTVFVGNLPVTCNKKKLKSFFKEYGQV-ESVRFRSVMPAE----GT 229

  Fly    78 VT----------YVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGF 132
            :|          :.|.||:......:..:...|.::...|...:.|:       :......|...
Mouse   230 LTKKLAAIKRKFHPDQKSINAYVVFKDESAAAKALQRNGAQIAEGFR-------IRVDLASETAS 287

  Fly   133 MNSKRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPR 197
            .:.:.:|:|.|....:::.:.|:|...|.:.:|:::.:..||..|.||::.|.:..:...||...
Mouse   288 RDKRSVFVGNLPYKIEDSALEEHFLDCGSIVAVRIVRNPLTGVGRGFGYVLFENTDAVHLALKLN 352

  Fly   198 KHWILQTLVEVKRSTQKADRRFRFPIFSSVRAGYIPPQPATADSYNYNNPNYNPYLAQSVLPPSA 262
            ...::...:.|.||..|.                           .....|.||.|.:.|:.|..
Mouse   353 NSELMGRKLRVMRSVNKE---------------------------KLKQQNSNPSLKKDVIKPKQ 390

  Fly   263 FTN 265
            ..|
Mouse   391 RLN 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 17/86 (20%)
RRM2_hnRNPA_like 137..209 CDD:240774 15/71 (21%)
Rbm34NP_766350.2 RRM1_RBM34 189..280 CDD:240840 19/102 (19%)
RRM2_RBM34 292..364 CDD:240841 15/71 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.