powered by:
Protein Alignment Rbp4 and AT5G03495
DIOPT Version :9
Sequence 1: | NP_476935.1 |
Gene: | Rbp4 / 41668 |
FlyBaseID: | FBgn0010258 |
Length: | 428 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001078524.1 |
Gene: | AT5G03495 / 5008197 |
AraportID: | AT5G03495 |
Length: | 226 |
Species: | Arabidopsis thaliana |
Alignment Length: | 52 |
Identity: | 13/52 - (25%) |
Similarity: | 26/52 - (50%) |
Gaps: | 0/52 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 143 LKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKAL 194
|:||..:.::.::|:..|.:..:.:..|.|.|..::..|:........||||
plant 40 LREYTVKLVLEKHFASCGKITHIYVPRDFERGILKSVAFMCIKGEGGEEKAL 91
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1202220at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.