DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and msi1

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_012816886.1 Gene:msi1 / 496961 XenbaseID:XB-GENE-490596 Length:347 Species:Xenopus tropicalis


Alignment Length:350 Identity:102/350 - (29%)
Similarity:143/350 - (40%) Gaps:83/350 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTI 97
            |:||||||.|||.|.||.:||.||.|.:.:|:|||::..||||||||::|...|:.|.....|.:
 Frog    21 KMFIGGLSWQTTQEGLREYFSHFGDVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHEL 85

  Fly    98 DNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFGPV 162
            |:|.::.|.|.||:...:               ....:|:||:|||........|::||.|||.|
 Frog    86 DSKTIDPKVAFPRRAQPK---------------MVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKV 135

  Fly   163 ASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKADRRFRFPIFS-- 225
            ....|:.|:.|.|.|.|||:.|......||......|.|...:||.|::..|       .:.|  
 Frog   136 DDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEINNKMVECKKAQPK-------EVMSPT 193

  Fly   226 -SVRA-------------------GYIPPQPAT---------ADSYNYNNPNYNPYLAQSVLPPS 261
             |||.                   ||...|.||         |..|.|..|.:.  :.::.||.:
 Frog   194 GSVRGRSRVMPYGMDAFMLGIGMLGYPGFQAATYASRSYTGIAPGYTYQFPEFR--VERTPLPGA 256

  Fly   262 AFTNGWAHYVIPMAPKPT--PGQNMAASLPSQQLAEHSLNGHGPDMWSSY-------PKTGIYSA 317
                       |:.|:.|  |   :.|..|....|...:.|..|.....:       |...:|.|
 Frog   257 -----------PVLPELTAIP---LTAYGPVAAAAAAVVRGSTPTRTGGFLGTSSPGPMAELYGA 307

  Fly   318 QEWTSS-----KVAEWGPKAGHKHA 337
            ....|:     ..|...|..|..|:
 Frog   308 ANQESAVSSYISAASPAPSTGFGHS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 38/76 (50%)
RRM2_hnRNPA_like 137..209 CDD:240774 27/71 (38%)
msi1XP_012816886.1 RRM1_MSI1 20..96 CDD:241203 37/74 (50%)
PABP-1234 <32..324 CDD:130689 90/329 (27%)
RRM2_MSI 110..183 CDD:240769 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.