DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AgaP_AGAP002959

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_001237407.3 Gene:AgaP_AGAP002959 / 4577309 VectorBaseID:AGAP002959 Length:913 Species:Anopheles gambiae


Alignment Length:188 Identity:46/188 - (24%)
Similarity:81/188 - (43%) Gaps:31/188 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DCKGDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFV 78
            |.:.|.|.     |.:..|::|:..||.:.|...:|..|....|  :::.|....|..|||||::
Mosquito   656 DSESDAKA-----GGDQSRQVFVSNLSFEVTETDIREIFPDLAI--ESIELVASSSGKSRGFGYM 713

  Fly    79 TYVD----PKSVEIVQR---ARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSK 136
            ....    ||::...:|   .||..|.| :...|...|.|              |...:.|..:|
Mosquito   714 QLASAEEVPKALSFDRRPLNGRPVFISN-VARDKTTRPHQ--------------FKYSSSFEPNK 763

  Fly   137 RIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKAL 194
             :|:.||.....:..:|..|..||.:..::::..| :|:.:...:||:...:||:.|:
Mosquito   764 -LFIKGLPFNLGQEELRRLFEPFGSIKDIRIVCFR-SGKSKGLAYLEYETETSAKNAV 819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 22/83 (27%)
RRM2_hnRNPA_like 137..209 CDD:240774 14/58 (24%)
AgaP_AGAP002959XP_001237407.3 RRM_SF 671..740 CDD:302621 19/70 (27%)
RRM_SF 760..840 CDD:302621 15/62 (24%)
Lsm_interact 895..913 CDD:283133
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.