DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AgaP_AGAP006668

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_001237856.2 Gene:AgaP_AGAP006668 / 4576768 VectorBaseID:AGAP006668 Length:360 Species:Anopheles gambiae


Alignment Length:200 Identity:58/200 - (28%)
Similarity:93/200 - (46%) Gaps:24/200 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYV 81
            |.|.:..:....:..||:|:||||.:||.:.||..|.|:|.:....|..||.:..||||.|:.|.
Mosquito    53 GGGGSDSQSNARDDERKLFVGGLSWETTEKDLREHFGQYGEIESINVKTDPNTGRSRGFAFIVYK 117

  Fly    82 DPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEY 146
            ...|::.|..|..|.::||.|:.|.|..|..                        :||:|||...
Mosquito   118 ASDSIDKVVAAGEHVLNNKKVDPKRAKARPG------------------------KIFVGGLTSD 158

  Fly   147 HDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRS 211
            ..:..::.:|.|||.:..|:|..|::..:::.|.|:.:.......:.|...|..|....|:||::
Mosquito   159 ISDEEIKTFFGQFGTIVEVELPFDKQKNQRKGFCFITYESVQVVNELLKTPKQTIAGKEVDVKKA 223

  Fly   212 TQKAD 216
            |.|.|
Mosquito   224 TPKPD 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 31/76 (41%)
RRM2_hnRNPA_like 137..209 CDD:240774 18/71 (25%)
AgaP_AGAP006668XP_001237856.2 RRM1_hnRNPA_hnRNPD_like 70..141 CDD:240771 28/70 (40%)
RRM_SF 149..223 CDD:302621 20/73 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.