DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and tra2b

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001006878.1 Gene:tra2b / 448667 XenbaseID:XB-GENE-5864557 Length:293 Species:Xenopus tropicalis


Alignment Length:166 Identity:41/166 - (24%)
Similarity:70/166 - (42%) Gaps:46/166 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GNCAS---SACLGDCKGDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLR 65
            ||.|:   :.|||                      :.|||..||...||..||::|.::|..::.
 Frog   113 GNRANPDPNCCLG----------------------VFGLSLYTTERDLREVFSKYGPISDVSIVY 155

  Fly    66 DPVSNHSRGFGFVTY--VDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGC 128
            |..|..||||.||.:  || .:.|..:||....:|.:.:....::.::......|:.....::| 
 Frog   156 DQQSRRSRGFSFVYFENVD-DAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGRPTYG- 218

  Fly   129 EAGFMNSKRIFLGGLKEYHDENI------VREYFSQ 158
                 :|:|      ::|:|...      .|||:|:
 Frog   219 -----SSRR------RDYYDRGYDRGGYDDREYYSR 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 25/78 (32%)
RRM2_hnRNPA_like 137..209 CDD:240774 7/28 (25%)
tra2bNP_001006878.1 RRM_SF 113..201 CDD:388407 31/110 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.