DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and elavl1

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001005461.1 Gene:elavl1 / 448062 XenbaseID:XB-GENE-481800 Length:326 Species:Xenopus tropicalis


Alignment Length:293 Identity:68/293 - (23%)
Similarity:108/293 - (36%) Gaps:80/293 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CKGD-GKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFV 78
            |:.| |:|           .:.:..|....|.:.||..||..|.|..|.::||.|:.||.|:|||
 Frog    13 CRDDIGRT-----------NLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFV 66

  Fly    79 TYVDPKSVE-IVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGG 142
            .|::.|..| .:.......:.:|.::...|.|..:                   .:....:::.|
 Frog    67 NYLNAKDAERAINTLNGLRLQSKTIKVSVARPSSE-------------------SIKDANLYISG 112

  Fly   143 LKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVE 207
            |.....:..|.:.|..||.:.:.::|:|:.||..|...|:.|...|.||:|:|.           
 Frog   113 LPRTMTQKDVEDMFLPFGRIINSRVLVDQATGLSRGVAFIRFDKRSEAEEAIAS----------- 166

  Fly   208 VKRSTQKADRRFRFPIFSSVRAGYIPP---QPATADSYNYNNPNYN---PYLAQSVLPPSAFTNG 266
                            |:    |:.||   :|.|...  ..|||.|   ..|:|....|:....|
 Frog   167 ----------------FN----GHKPPGSSEPITVKF--AANPNQNKNMALLSQLCHSPARRFGG 209

  Fly   267 WAHY------VIPMA---PKPTPGQNMAASLPS 290
            ..|:      ..||.   .....|.|:|:|..|
 Frog   210 PVHHQAQRFRFSPMGVDHMSSISGVNVASSASS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 23/77 (30%)
RRM2_hnRNPA_like 137..209 CDD:240774 18/71 (25%)
elavl1NP_001005461.1 RRM 19..326 CDD:330708 65/287 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.