DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and Hrb98DE

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster


Alignment Length:186 Identity:73/186 - (39%)
Similarity:116/186 - (62%) Gaps:13/186 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRAR 93
            ||:||:|||||..:||.|.|:..|.::|.:.|.||::||.:..||||||:||.....::..|::|
  Fly    28 EHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSR 92

  Fly    94 PHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQ 158
            ||.||.::||.|.|:||||.. ....|:.|            |::|:|.||:.|||..:|:||..
  Fly    93 PHKIDGRVVEPKRAVPRQDID-SPNAGATV------------KKLFVGALKDDHDEQSIRDYFQH 144

  Fly   159 FGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQK 214
            ||.:..:.:::|:|||::|.|.|:||.|....:|.:..::|.:...:|:||::..|
  Fly   145 FGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 35/76 (46%)
RRM2_hnRNPA_like 137..209 CDD:240774 25/71 (35%)
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 35/76 (46%)
RRM_SF 123..195 CDD:302621 25/71 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463974
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA81
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.