DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and Syp

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster


Alignment Length:209 Identity:45/209 - (21%)
Similarity:86/209 - (41%) Gaps:38/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTI 97
            ::|.|.:......:.|...|...||:.|..::.||::..:||:.|||:.:.::.           
  Fly   207 EVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAA----------- 260

  Fly    98 DNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFGPV 162
                |.....|...:.:.|..:|..: ||       |:.|:|:|.:.:..|.:.:.|.||:..|.
  Fly   261 ----VNAVRQLNDFEIRTGKKIGVTI-SF-------NNHRLFVGNIPKNRDRDELIEEFSKHAPG 313

  Fly   163 ASVKLLMDR--ETGRQRAFGFLEFVDPSSAEKALAPR-------KHWILQTLVEVKRSTQKADRR 218
            ....::...  :..:.|.|.|||:....:|  :||.|       |.|....:|:.....::.|.:
  Fly   314 LYEVIIYSSPDDKKKNRGFCFLEYESHKAA--SLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQ 376

  Fly   219 FRFPIFSSVRAGYI 232
                ..|.|:..|:
  Fly   377 ----TMSKVKVLYV 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 16/76 (21%)
RRM2_hnRNPA_like 137..209 CDD:240774 20/80 (25%)
SypNP_001262777.1 RRM1_hnRNPR_like 205..283 CDD:240695 18/91 (20%)
RRM2_hnRNPR_like 286..367 CDD:240696 20/82 (24%)
RRM3_hnRNPR_like 381..452 CDD:240697 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464016
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.