DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and CG5213

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:189 Identity:49/189 - (25%)
Similarity:70/189 - (37%) Gaps:40/189 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GYEHLRKIFIGG----------------------LSTQTTVETLRGFFSQFGIVADAVVLRDPVS 69
            ||..:|.:|..|                      |....|...|...||:||.:..|.::|...:
  Fly    14 GYAGIRGMFQTGRPVDPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRT 78

  Fly    70 NHSRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMN 134
            ..|..:|||.||..:..    .|..:.:|.  .||:....:..|.|.....|            .
  Fly    79 GISCCYGFVDYVSERQA----AAAVNGMDG--YETRGKRLKVAFARPSEYES------------T 125

  Fly   135 SKRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKA 193
            |..:::|.|..|.||..|||.|:.:|.:..|.||..:...|.|...||:|.....||.|
  Fly   126 SSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVA 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 21/98 (21%)
RRM2_hnRNPA_like 137..209 CDD:240774 21/57 (37%)
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 19/81 (23%)
RRM 128..202 CDD:214636 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.