DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and sqd

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster


Alignment Length:246 Identity:69/246 - (28%)
Similarity:111/246 - (45%) Gaps:31/246 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DAGNCASSACLGDCKGDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRD 66
            |||...|:    :...|.::|...:..:. ||:|:||||.:||.:.||..|.::|.:....|..|
  Fly    31 DAGAAGST----NGSSDNQSAASGQRDDD-RKLFVGGLSWETTEKELRDHFGKYGEIESINVKTD 90

  Fly    67 PVSNHSRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAG 131
            |.:..||||.|:.:.:.::::.|..|..|.|::|.|:.|.|..|..                   
  Fly    91 PQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARHG------------------- 136

  Fly   132 FMNSKRIFLGGL-KEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALA 195
                 :||:||| .|..||.| :.||.|||.:..|::..|::..:::.|.|:.|.........|.
  Fly   137 -----KIFVGGLTTEISDEEI-KTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLK 195

  Fly   196 PRKHWILQTLVEVKRSTQKADRRFRFPIFSSVRAGYIPPQPATADSYNYNN 246
            ..|..|....|:|||:|.|.:.:....:....|.|....:........|||
  Fly   196 TPKQKIAGKEVDVKRATPKPENQMMGGMRGGPRGGMRGGRGGYGGRGGYNN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 28/76 (37%)
RRM2_hnRNPA_like 137..209 CDD:240774 23/72 (32%)
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 25/70 (36%)
RRM2_hnRNPD_like 137..211 CDD:240775 25/74 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464021
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.