DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and SLIRP2

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_649808.1 Gene:SLIRP2 / 41021 FlyBaseID:FBgn0037602 Length:91 Species:Drosophila melanogaster


Alignment Length:85 Identity:23/85 - (27%)
Similarity:47/85 - (55%) Gaps:1/85 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 AGFMNSK-RIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKA 193
            :||:.|. ::|:|.|........:|.|||::|.||:.:::.||:.|..:.:||:.|....:...|
  Fly     3 SGFVRSSYKLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSA 67

  Fly   194 LAPRKHWILQTLVEVKRSTQ 213
            .....|::...::.|:|:.:
  Fly    68 SNQNTHFLDGRVLTVQRANE 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621
RRM2_hnRNPA_like 137..209 CDD:240774 18/71 (25%)
SLIRP2NP_649808.1 RRM_SLIRP 11..83 CDD:240688 18/71 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464007
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.