DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and cocoon

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster


Alignment Length:294 Identity:79/294 - (26%)
Similarity:119/294 - (40%) Gaps:77/294 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DGKTAIKEEGYEHLR--KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTY 80
            :..||..:....|||  .:.:.|||..||.:.||.:|..:|.|..|.:.:|..|.||:|||||.:
  Fly    91 ENSTAKTKRTEAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRF 155

  Fly    81 VDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKE 145
             ....|::...::.|:||.:..|.|....|       |:|:.      |.|     ::|:|...|
  Fly   156 -GSYDVQMHVLSKRHSIDGRWCEVKVPASR-------GMGNQ------EPG-----KVFVGRCTE 201

  Fly   146 YHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEV-- 208
            ..:.:.:|||||:||.|..|.:     ....|||.|:.|:|| ...:.:...||.|....|.|  
  Fly   202 DIEADDLREYFSKFGEVIDVFI-----PKPFRAFSFVTFLDP-YVPRVVCGEKHIIKGVSVHVST 260

  Fly   209 --KRSTQKADRRFRFPIFSSVRAGYIPPQPATADSYNYNNPNYNPYLAQSVLPPSAFTNGWAHYV 271
              |::.|..::.|:                    :.||||.:.|            |        
  Fly   261 ADKKNVQNKNQLFQ--------------------TNNYNNLDNN------------F-------- 285

  Fly   272 IPMAPKPTPGQNMAASLPSQQLAEHSLNGHGPDM 305
                 |..|..|.... |:...:.||.|.||..|
  Fly   286 -----KMQPANNFRMH-PANNFSMHSFNPHGYQM 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 26/76 (34%)
RRM2_hnRNPA_like 137..209 CDD:240774 24/75 (32%)
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767 26/76 (34%)
RRM2_TDP43 193..262 CDD:240768 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.