DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and tia1

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_012814227.2 Gene:tia1 / 394890 XenbaseID:XB-GENE-1002876 Length:389 Species:Xenopus tropicalis


Alignment Length:320 Identity:62/320 - (19%)
Similarity:118/320 - (36%) Gaps:103/320 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKS 85
            :.::.:.:.|   :|:|.||.:.|.:.::..|:.||.::||.|::|..:..|:|:|||::.:...
 Frog    98 STLRSQDHFH---VFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWD 159

  Fly    86 VE-IVQRARPHTIDNKIVET-----KHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKR------- 137
            .| .:.:.....:..:.:.|     |...|:..::                  .|:|:       
 Frog   160 AENAIAQMGGQWLGGRQIRTNWATRKPPAPKSTYE------------------SNTKQLTYEEVV 206

  Fly   138 ---------IFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKA 193
                     ::.||:.....|.::|:.||.||.:..|::..|      :.:.|:.|....||..|
 Frog   207 NQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFPD------KGYSFVRFSSHESAAHA 265

  Fly   194 LAP-----------RKHW------ILQTLVEVKRSTQKADRRFRFPIFSSVRAGYIPPQPATADS 241
            :..           :.:|      :|..:.:|..::|     ..||          ||.......
 Frog   266 IVSVNGTTIEGHVVKCYWGKETPDMLNPVQQVSEASQ-----ISFP----------PPYGQWGQW 315

  Fly   242 Y------------NYNNPNYNPY------LAQSVLPPSAFTNGWAHYVIPMAPKPTPGQN 283
            |            .:..|.|..|      ...|..|.||.|....:|.:    :|.||||
 Frog   316 YGGAQQIGQYVPNGWQMPAYGVYGQAWSQQGYSQTPSSAATWVGPNYGV----QPQPGQN 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 20/82 (24%)
RRM2_hnRNPA_like 137..209 CDD:240774 17/104 (16%)
tia1XP_012814227.2 RRM1_TIA1 8..81 CDD:410027
RRM2_TIA1 104..181 CDD:410030 20/79 (25%)
RRM3_TIAR 214..286 CDD:241064 16/77 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.