DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and msi2b

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_957403.1 Gene:msi2b / 394084 ZFINID:ZDB-GENE-040426-1268 Length:408 Species:Danio rerio


Alignment Length:372 Identity:106/372 - (28%)
Similarity:163/372 - (43%) Gaps:90/372 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KGDGKTAIK---EEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGF 77
            :|||..|..   .:......|:||||||.||:.::||.:||:||.:.:.:|:|||.:..||||||
Zfish     2 EGDGSQATSGSPNDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGF 66

  Fly    78 VTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGG 142
            ||:.|..||:.|.....|.:|:|.::.|.|.||:...:               ....:|:||:||
Zfish    67 VTFADAASVDKVLAQPHHELDSKTIDPKVAFPRRAQPK---------------MVTRTKKIFVGG 116

  Fly   143 LKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVE 207
            |........|::||.|||.|....|:.|:.|.|.|.|||:.|.:....||......|.|...:||
Zfish   117 LSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVE 181

  Fly   208 VKRSTQKADRRFRFPIFSSVRAGYIP---------------PQ-PAT--------ADSYNYNNPN 248
            .|::..|   ...||..:..||..:|               |. .||        |.||:|..|.
Zfish   182 CKKAQPK---EVMFPPGTRGRARGLPYTMDAFMLGMGMLSYPNIVATYGRGYTGFAPSYSYQFPG 243

  Fly   249 YNPYLAQSVLPPSAFTNGWAHYVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHGPDMWSSYPKT- 312
            :         |.:|:.        |:|        .||::.:.:.:.....|.|.  :::||:: 
Zfish   244 F---------PATAYG--------PVA--------AAAAVAAARGSGRGARGRGG--YAAYPQST 281

  Fly   313 -------GIYSA---QEWTSSKVAEW---GPKAGH----KHAQTSTN 342
                   |.||:   |.......|::   ||:|..    :||.::.|
Zfish   282 GPGFPDYGFYSSPSDQRGPPFSFADYGSLGPQAAQLLQSEHATSACN 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 36/76 (47%)
RRM2_hnRNPA_like 137..209 CDD:240774 27/71 (38%)
msi2bNP_957403.1 RRM <2..162 CDD:223796 64/174 (37%)
RRM1_MSI 23..97 CDD:241020 34/73 (47%)
RRM2_MSI 111..184 CDD:240769 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.