DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and hnrnpa1a

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_021335234.1 Gene:hnrnpa1a / 393467 ZFINID:ZDB-GENE-040426-1546 Length:445 Species:Danio rerio


Alignment Length:229 Identity:74/229 - (32%)
Similarity:115/229 - (50%) Gaps:46/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TAIKEEGY-----EHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAV------------------ 62
            ||:.:|..     |.|||:||||||.:||.|:||..|.|:|.:.|.|                  
Zfish    22 TAMSKEQQTPREPEQLRKLFIGGLSFETTDESLRAHFEQWGTLTDCVVSPSAAIHMLMYEREEHL 86

  Fly    63 ----------VLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGG 117
                      |:|||.:..|||||||||.....|:....||||.:|.:.||.|.|:.|:|..:.|
Zfish    87 KVAGFLYCSQVMRDPNTKRSRGFGFVTYSSVGEVDAAMDARPHKVDGRAVEPKRAVSREDSSKPG 151

  Fly   118 GVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFL 182
            ...:|             |::|:||:||..||..:||||.|||.:..|.::.::.:.::|.|.|:
Zfish   152 AHSTV-------------KKMFVGGIKEDTDEEHLREYFGQFGKIDEVNIMTEKNSDKRRGFAFI 203

  Fly   183 EFVDPSSAEKALAPRKHWILQTLVEVKRSTQKAD 216
            .|.|..:.::.:..:.|.:.....||:::..:.:
Zfish   204 TFDDHDAVDRIVIQKYHTVNGHNCEVRKALSREE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 40/104 (38%)
RRM2_hnRNPA_like 137..209 CDD:240774 22/71 (31%)
hnrnpa1aXP_021335234.1 RRM_SF 36..144 CDD:327398 42/107 (39%)
RRM_SF 157..233 CDD:327398 24/75 (32%)
HnRNPA1 376..>392 CDD:314495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.