DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and CG3335

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster


Alignment Length:396 Identity:87/396 - (21%)
Similarity:139/396 - (35%) Gaps:109/396 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAGNCASSACLGDCKGDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLR 65
            :||||       ...|....:..||:......:||...|:..||.|.||..|.|||.|.:..:..
  Fly   340 VDAGN-------AKWKHQQDSLSKEDDISESGRIFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPL 397

  Fly    66 DPVSNHSRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETK--HALPRQDFKRGGGVGSVVGSFGC 128
            |.::...:|||.|||:.|   |...:|. :|:|......:  |.||.:|.::..           
  Fly   398 DKLTRKIKGFGTVTYMMP---EHALKAF-NTLDGTDFHGRLLHLLPSKDIEKNP----------- 447

  Fly   129 EAGFMNSKRIFLGGLKEYHDENIVREYFSQ--------------------FGPVASVKLLMDR-E 172
                           ||..|||.....|.:                    .|..|..::|..: :
  Fly   448 ---------------KEDLDENDASLSFKEKKALKLKKNAQKPIGWNTLFLGANAVAEILAKQFK 497

  Fly   173 TGRQRAFGFLEFVD-PSSAEKALAPRKHWILQTLVEVKRSTQKADRR---FRFPIFSSVRAGYIP 233
            |.::|   .|:..| .|||...||..:   .|.::|:||..::...|   |..|.........:.
  Fly   498 TSKER---ILDTSDGGSSAAVRLALGE---TQVVIEMKRFLEEEGVRLDAFDEPAKKRSNTVILA 556

  Fly   234 PQPATADSYNYNNPNYNPY--LAQSVLPPSAFTNGWAHYVIPMAPKPTPGQNMAASLPSQQLAEH 296
            .....|...:...|.::.:  :.:.|||||..| ....|..|          :.|....::||  
  Fly   557 KNLPAATEISEITPIFSRFGPIGRIVLPPSGVT-ALIEYCDP----------LEARQAFKKLA-- 608

  Fly   297 SLNGHGPDMWSSYPKTGIYSAQEWTSSKV-------------AEWGPKAGHKHAQTSTNDRAKID 348
                     :|.:....:|  .||...:|             :|..||...|..:....:.||.|
  Fly   609 ---------YSKFKNAPLY--LEWAPEQVFTKTLSGEPVIPKSEPKPKEEVKPEEKPIVNDAKPD 662

  Fly   349 LKELQA 354
            .::.:|
  Fly   663 EEDSRA 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 27/78 (35%)
RRM2_hnRNPA_like 137..209 CDD:240774 20/93 (22%)
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011 27/81 (33%)
RRM4_RBM19 552..623 CDD:241013 17/94 (18%)
RRM <638..845 CDD:223796 8/31 (26%)
RRM5_RBM19_like 679..760 CDD:240764
RRM6_RBM19 785..864 CDD:241015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464025
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.