DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and hnrnpa1b

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_956398.1 Gene:hnrnpa1b / 378453 ZFINID:ZDB-GENE-030912-14 Length:422 Species:Danio rerio


Alignment Length:215 Identity:79/215 - (36%)
Similarity:121/215 - (56%) Gaps:26/215 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ACLGDCKGDGKTAI----KEEGY----EHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRD 66
            ||     |..:|.|    .:||.    |.|||:||||||.:||.::||..|.|:|.:.|.||::|
Zfish     8 AC-----GVARTEIVGRMSKEGQPREPEQLRKLFIGGLSFETTDDSLRAHFEQWGTLTDCVVMKD 67

  Fly    67 PVSNHSRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAG 131
            |.:..|||||||||.....|.....||||.:|.::||.|.|:.|:|..:.....:|         
Zfish    68 PNTKRSRGFGFVTYSSVDEVNASMDARPHKVDGRLVEPKRAVSREDSSKPFAHTTV--------- 123

  Fly   132 FMNSKRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAP 196
                |:||:||:|:..:||.:|:||.|||.:..|::::|.:||.:|.|.|:.|.|..|.::.:..
Zfish   124 ----KKIFVGGIKDDTEENHLRDYFDQFGKIEVVEIMVDHKTGNKRGFAFVTFDDHDSVDRIVIQ 184

  Fly   197 RKHWILQTLVEVKRSTQKAD 216
            :.|.:.....||:::..|.:
Zfish   185 KYHTVNGHNCEVRKALSKQE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 38/76 (50%)
RRM2_hnRNPA_like 137..209 CDD:240774 25/71 (35%)
hnrnpa1bNP_956398.1 RRM <19..187 CDD:223796 70/180 (39%)
RRM_SF 31..111 CDD:302621 40/79 (51%)
RRM2_hnRNPA1 124..200 CDD:241024 27/75 (36%)
HnRNPA1 367..>387 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA81
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.