DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and TBPH

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001163280.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster


Alignment Length:404 Identity:92/404 - (22%)
Similarity:151/404 - (37%) Gaps:107/404 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTY--VDPKSVEIVQRARPHT 96
            :.:.||..:||.|:||.:|..:|.|..|.:.:|..|..|:|||||.:  .|.:...:..|   |.
  Fly   109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNR---HL 170

  Fly    97 IDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFGP 161
            ||.:..|.|  :|...     |:|..|   .|        ::|:|...|..:.:.:|||||:||.
  Fly   171 IDGRWCEVK--VPNSK
-----GMGHQV---PC--------KVFVGRCTEDINSDDLREYFSKFGE 217

  Fly   162 VASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKADRRFRFPIFSS 226
            |..|  .:.|..   |||.|:.|:||..|: :|....|.|....|.|..:..||::.        
  Fly   218 VTDV--FIPRPF---RAFSFVTFLDPDVAQ-SLCGEDHIIKGVSVHVSNAAPKAEQN-------- 268

  Fly   227 VRAGYIPPQPATADSYNYNNPNYNPYLAQSVLPPSAFTNGWAHYVIPMAPKPTPGQN-------- 283
                    :.....|||||:.|                :...|...|......||:|        
  Fly   269 --------RNQQVQSYNYNSAN----------------SFGMHSYHPQGNHMNPGRNGHHRGNNQ 309

  Fly   284 ------MAASLPSQQLAEHSL---------NGHGPDMWSSYPKTG----------------IYSA 317
                  ..|.:|:    .|::         |.:|.:....|...|                .|::
  Fly   310 HNAHGGENAIVPN----NHNIGTAGYGMGGNNYGGNSGGGYHNNGGNHSSGGNTNRQDGGSQYNS 370

  Fly   318 QEWTSSKVAEWGPKAGHKHAQTSTNDRAKIDLKELQAATFNNKLDFGARGDADRMSGAGLGL-GL 381
            ::.....:.:  |..|:........:|..:|:..|||...|::....:....:..:.:.|.| .|
  Fly   371 RQSNFHGMNQ--PHNGNVGGSNGWMNRGHLDMPNLQALGINSQGSSSSNQGQNMSNQSMLNLNSL 433

  Fly   382 TGGAAVGVGAIKKW 395
            ....|:...|:.:|
  Fly   434 PINPALVAAALNQW 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 26/77 (34%)
RRM2_hnRNPA_like 137..209 CDD:240774 25/71 (35%)
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767 27/79 (34%)
RRM2_TDP43 192..261 CDD:240768 27/82 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.