DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and tra2

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster


Alignment Length:148 Identity:37/148 - (25%)
Similarity:59/148 - (39%) Gaps:32/148 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 SKRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKA------ 193
            |:.|.:.||.....::.|||.|:::||:..:::::|.:|.|.|.|.|:.|...|.|..|      
  Fly    96 SRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSG 160

  Fly   194 -------------LAPRKHWILQTLVEVKRSTQKADRRFRFPIFSSVRAG-------YIPPQPAT 238
                         :..|.|.....:...::...||.|.|      |.|.|       ...|....
  Fly   161 IEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSF------SPRRGRRVYHDRSASPYDNY 219

  Fly   239 ADSYNYNNPNYNPYLAQS 256
            .|.|:|.|..|:..|.:|
  Fly   220 RDRYDYRNDRYDRNLRRS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621
RRM2_hnRNPA_like 137..209 CDD:240774 21/90 (23%)
tra2NP_476764.1 RRM <74..242 CDD:223796 37/148 (25%)
RRM_TRA2 98..175 CDD:240809 19/76 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.