DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and Hnrnpa3

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001104764.1 Gene:Hnrnpa3 / 362152 RGDID:727807 Length:379 Species:Rattus norvegicus


Alignment Length:197 Identity:74/197 - (37%)
Similarity:119/197 - (60%) Gaps:18/197 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EEGY-----EHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPK 84
            |||:     |.|||:||||||.:||.::||..|.::|.:.|.||:|||.:..|||||||||...:
  Rat    23 EEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVE 87

  Fly    85 SVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDE 149
            .|:....||||.:|.::||.|.|:.|:|..:.|             ..:..|:||:||:||..:|
  Rat    88 EVDAAMCARPHKVDGRVVEPKRAVSREDSVKPG-------------AHLTVKKIFVGGIKEDTEE 139

  Fly   150 NIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQK 214
            ..:|:||.::|.:.:::::.||::|::|.|.|:.|.|..:.:|.:..:.|.|.....|||::..|
  Rat   140 YNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSK 204

  Fly   215 AD 216
            .:
  Rat   205 QE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 38/76 (50%)
RRM2_hnRNPA_like 137..209 CDD:240774 23/71 (32%)
Hnrnpa3NP_001104764.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 4/11 (36%)
RRM1_hnRNPA_like 36..113 CDD:409992 38/76 (50%)
RRM2_hnRNPA3 126..205 CDD:409996 26/78 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..225 1/3 (33%)
HnRNPA1 332..>348 CDD:402981
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 335..379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.