DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and Msi2

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_038943587.1 Gene:Msi2 / 360596 RGDID:1560397 Length:354 Species:Rattus norvegicus


Alignment Length:346 Identity:102/346 - (29%)
Similarity:150/346 - (43%) Gaps:73/346 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTI 97
            |:||||||.||:.::||.:||:||.:.:.:|:|||.:..||||||||:.||.||:.|.....|.:
  Rat    22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL 86

  Fly    98 DNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFGPV 162
            |:|.::.|.|.||:...:               ....:|:||:|||........|::||.|||.|
  Rat    87 DSKTIDPKVAFPRRAQPK---------------MVTRTKKIFVGGLSANTVVEDVKQYFEQFGKV 136

  Fly   163 ASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKADRRFRFPIFSSV 227
            ....|:.|:.|.|.|.|||:.|.:....||......|.|...:||.|::..|   ...||..:..
  Rat   137 EDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPK---EVMFPPGTRG 198

  Fly   228 RAGYIP---------------PQ---------PATADSYNYNNPNYNPYLAQSVLPPSAF----- 263
            ||..:|               |.         |..|.||.|..|...|||..| .|.:|:     
  Rat   199 RARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPALLPYLNAS-FPAAAYGPVAA 262

  Fly   264 ----------TNGWA---HYVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHGP--DMWSSYPKTG 313
                      .|.::   ::..|.:|        |.|.|::.......|..||  |::.  |.:.
  Rat   263 AAVAAARGSVLNSYSAQPNFGAPTSP--------AGSNPARPGGFPGANSPGPVADLYG--PASQ 317

  Fly   314 IYSAQEWTSSKVAEWGPKAGH 334
            ......:.|:...:.|...||
  Rat   318 DSGVGNYISAASPQPGSGFGH 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 37/76 (49%)
RRM2_hnRNPA_like 137..209 CDD:240774 27/71 (38%)
Msi2XP_038943587.1 RRM1_MSI2 17..109 CDD:410153 39/101 (39%)
PABP-1234 <35..351 CDD:130689 93/333 (28%)
RRM2_MSI 111..184 CDD:240769 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.