DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and Secp43

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster


Alignment Length:397 Identity:74/397 - (18%)
Similarity:148/397 - (37%) Gaps:93/397 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIFIGGLSTQTTVETLRGFFSQFGIVADAV-VLRDPVSNHSRGFGFVTYV-DPKSVEIVQRARPH 95
            ::::|.|.:..|...:...|.:.|.....| ::|:..:....|:.||.:: |..:::.:     |
  Fly     7 QLWMGSLESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPAGYCFVNFISDDHALDAM-----H 66

  Fly    96 TIDNKIVETKHALPRQDFKRGGGVGSVVGSF---GCEAGFMNSKRIFLGGL-KEYHDENIVREYF 156
            .::.|.:...:.:.|  |:    :.|...|:   |.|..|    .:::|.| .:..|..:.:.:.
  Fly    67 KLNGKPIPGTNPIVR--FR----LNSASNSYKLPGNEREF----SVWVGDLSSDVDDYQLYKVFS 121

  Fly   157 SQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKADRRFRF 221
            |:|..:.:.|:::| ..|..:.:||:.|......:.||.....:|......:|            
  Fly   122 SKFTSIKTAKVILD-SLGFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIK------------ 173

  Fly   222 PIFSSVRAGYIPPQPATA---------DSYNYNN-------PNYNPYLAQSVLPPSAFTNG---W 267
             |.::|      |:|.:.         .:|.|.:       .:|:.|..    |.|.:..|   |
  Fly   174 -ICNAV------PKPKSELGGAVGEGNTNYGYGSGMTAAGGTDYSQYYD----PTSTYWQGYQAW 227

  Fly   268 AHYVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHGPDMWSSYPKTGIYSAQEWTSSKVAEWGPKA 332
            ..|........|.    ||:...|.:::...|          |:|....|:.|::.:.|::..:.
  Fly   228 QGYYEQAGASITD----AAAYYQQAMSQSHSN----------PQTLAQHAEAWSAQRSAQYEQQQ 278

  Fly   333 GHKHAQTSTNDRAKIDLKELQAATFNNKLDFGARGDADRMSGAGLGLGLTGGAAVGVGAIKKW-P 396
            ..:.|..:.....:..|.|.:.....:||:..|. ||||.....|             ...|| |
  Fly   279 QQQTASAANGAEDENGLVEHKFVLDVDKLNREAI-DADRRLYDAL-------------ESSKWLP 329

  Fly   397 TQDYKVF 403
            .:..:||
  Fly   330 IEQLEVF 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 13/78 (17%)
RRM2_hnRNPA_like 137..209 CDD:240774 14/72 (19%)
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 16/93 (17%)
RRM2_SECp43 99..180 CDD:241056 18/104 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463931
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.