DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and Rbp9

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001259974.1 Gene:Rbp9 / 33498 FlyBaseID:FBgn0010263 Length:684 Species:Drosophila melanogaster


Alignment Length:375 Identity:73/375 - (19%)
Similarity:132/375 - (35%) Gaps:107/375 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVE-IVQRARPHTI 97
            :.:..|....:.:.:|..|..||.|....::||.|:..|.|:|||.||..:..| .:.......:
  Fly   112 LIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINALNGLRL 176

  Fly    98 DNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFGPV 162
            .||.::...|.|..:..:|.                   .:::.||.:...::.:...||.:|.:
  Fly   177 QNKTIKVSIARPSSESIKGA-------------------NLYVSGLPKNMTQSDLESLFSPYGKI 222

  Fly   163 ASVKLLMDRETGRQRAFGFLEFVDPSSAEKAL------APRKHWILQTLVEVKRSTQKADRRFRF 221
            .:.::|.|..||..:..||:.|.....|::|:      .|            |.||:....:|..
  Fly   223 ITSRILCDNITGLSKGVGFIRFDQRFEADRAIKELNGTTP------------KNSTEPITVKFAN 275

  Fly   222 PIFSSVR-----AGYIPPQ------------------PATADSYNYNNPNYNPYLAQ-SVLPPSA 262
            ...|:..     |.||.||                  .|.|.:.:.|...|:..::: |.|....
  Fly   276 NPSSNKNSMQPLAAYIAPQNTRGGRAFPANAAAGAAAAAAAAAIHPNAGRYSSVISRYSPLTSDL 340

  Fly   263 FTN-----------GWAHYVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHGPDMWSSYPKTGIYS 316
            .||           ||..:|..:||.                .|.::      :|..:...|...
  Fly   341 ITNGMIQGNTIASSGWCIFVYNLAPD----------------TEENV------LWQLFGPFGAVQ 383

  Fly   317 A----QEWTSSKVAEWGPKAGHKHAQTSTN-DRAKIDLKELQAATFNNKL 361
            :    ::..|:|...:|       ..|.|| :.|.:.::.|...|..|::
  Fly   384 SVKVIRDLQSNKCKGFG-------FVTMTNYEEAVLAIQSLNGYTLGNRV 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 20/76 (26%)
RRM2_hnRNPA_like 137..209 CDD:240774 15/77 (19%)
Rbp9NP_001259974.1 ELAV_HUD_SF 107..438 CDD:273741 73/375 (19%)
RRM1_Hu 109..186 CDD:241094 19/73 (26%)
RRM2_Hu 196..274 CDD:241096 18/108 (17%)
RRM3_Hu 355..432 CDD:240823 18/101 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.