DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and hnrnpa0b

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_999871.1 Gene:hnrnpa0b / 334222 ZFINID:ZDB-GENE-030131-6154 Length:314 Species:Danio rerio


Alignment Length:188 Identity:75/188 - (39%)
Similarity:111/188 - (59%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRAR 93
            |.|.|:|:|||:.|||.:.||.:|.|||.:.|.||:::.....||.||||||...:..:....||
Zfish     5 EKLCKLFVGGLNVQTTNDGLRSYFEQFGNLTDCVVVQNDQLQRSRCFGFVTYSTSEEADAAMAAR 69

  Fly    94 PHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQ 158
            ||.:|.|.||.|.|:.|:|..|...:..|             |:||:||||:..:|..:.|:|||
Zfish    70 PHVVDGKNVEVKRAVAREDAGRPEALAKV-------------KKIFVGGLKDDIEEKDLTEFFSQ 121

  Fly   159 FGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKAD 216
            ||.:...:::.|::||::|.|||:.|.|..||:||:..:.|.|....||||::..|.:
Zfish   122 FGMIEKSEVITDKDTGKKRGFGFVHFEDNDSADKAVVLKFHMINGHKVEVKKALTKQE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 35/76 (46%)
RRM2_hnRNPA_like 137..209 CDD:240774 30/71 (42%)
hnrnpa0bNP_999871.1 RRM1_hnRNPA0 6..84 CDD:240772 35/77 (45%)
RRM_SF 100..179 CDD:302621 33/78 (42%)
HnRNPA1 263..294 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.