DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AgaP_AGAP002374

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_563821.4 Gene:AgaP_AGAP002374 / 3290608 VectorBaseID:AGAP002374 Length:362 Species:Anopheles gambiae


Alignment Length:188 Identity:80/188 - (42%)
Similarity:120/188 - (63%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRAR 93
            |||||:|||||..:||.:||:.:|.::|.|.|.||::||.:..||||||:||.....::..|.:|
Mosquito    26 EHLRKLFIGGLDYRTTDDTLKAYFEKWGKVVDVVVMKDPKTKRSRGFGFITYSKSYMIDDAQASR 90

  Fly    94 PHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQ 158
            ||.||.::||.|.|:||||..|.            ||| .:.|::|:|||::..||..:|||||:
Mosquito    91 PHKIDGRVVEPKRAVPRQDINRP------------EAG-SSVKKLFVGGLRDDFDEEHLREYFSK 142

  Fly   159 FGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKAD 216
            :|.|.|..::.|::.|::|.|||:||.|....:|.:..:.|.|...|::||::..|.|
Mosquito   143 YGNVISACIVTDKDNGKKRGFGFVEFDDYDPVDKIILQKSHTIQNKLLDVKKALPKQD 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 36/76 (47%)
RRM2_hnRNPA_like 137..209 CDD:240774 27/71 (38%)
AgaP_AGAP002374XP_563821.4 RRM1_hnRNPA_like 30..107 CDD:241022 36/76 (47%)
RRM2_hnRNPA_like 121..193 CDD:240774 27/71 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA81
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.