DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and hnrnpa0l

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001268650.1 Gene:hnrnpa0l / 321899 ZFINID:ZDB-GENE-030131-618 Length:302 Species:Danio rerio


Alignment Length:186 Identity:71/186 - (38%)
Similarity:109/186 - (58%) Gaps:13/186 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPH 95
            |.|:|:|||:.|||.|.||..|.|:|.:.|.||:.:.....||.||||||...:..:....||||
Zfish     5 LCKLFVGGLNVQTTDEGLRAHFEQYGQLTDCVVVMNQPLQRSRCFGFVTYSSTEEADAAMSARPH 69

  Fly    96 TIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFG 160
            .:|...|:.|.|:.|:|..:...:..|             |:||:||||:..::..:::||||||
Zfish    70 IVDGNNVDLKRAVAREDAGKPEMLAKV-------------KKIFVGGLKDDIEDEHLQDYFSQFG 121

  Fly   161 PVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKAD 216
            |:...:::.|::||::|.|||:.|.|..||:||:..:.|.|....||||::..|.:
Zfish   122 PIEKAQVITDKDTGKKRGFGFVYFDDNDSADKAVVMKFHSICGHKVEVKKALTKQE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 33/76 (43%)
RRM2_hnRNPA_like 137..209 CDD:240774 30/71 (42%)
hnrnpa0lNP_001268650.1 RRM1_hnRNPA0 4..82 CDD:240772 33/76 (43%)
RRM_SF 98..177 CDD:302621 33/78 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.