DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and hnrnpaba

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_997752.2 Gene:hnrnpaba / 321466 ZFINID:ZDB-GENE-030131-185 Length:340 Species:Danio rerio


Alignment Length:219 Identity:65/219 - (29%)
Similarity:106/219 - (48%) Gaps:28/219 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GNCASSACLGDCKGDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPV 68
            ||..:....||...||......:|.|...|:|:||||..|:.:.|:.:||:||.|.|..:..||.
Zfish    41 GNAGADGTAGDDGADGGQIDASKGEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDPN 105

  Fly    69 SNHSRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFM 133
            :..||||||:.:.:|..|:.|...:.|.:|.:.::.|.|:..:.                    .
Zfish   106 TGRSRGFGFILFKEPSGVDKVLAQKEHRLDGRQIDPKKAMAMKK--------------------E 150

  Fly   134 NSKRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRK 198
            ..|:||:|||.....|..:||||..||.:.:::|.||.::.::|.|.|:.|.:..:.:|.|..:.
Zfish   151 PVKKIFVGGLNPETTEERIREYFGAFGEIETIELPMDPKSNKRRGFVFITFKEEEAVKKILEKKY 215

  Fly   199 HWILQT--------LVEVKRSTQK 214
            |.:..|        |.|:|.:..|
Zfish   216 HNVSGTKDTSGKEGLCEIKIAQPK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 29/76 (38%)
RRM2_hnRNPA_like 137..209 CDD:240774 25/79 (32%)
hnrnpabaNP_997752.2 CBFNT 1..69 CDD:285369 8/27 (30%)
RRM1_hnRNPAB 70..144 CDD:241201 28/73 (38%)
RRM2_hnRNPAB 149..228 CDD:241028 24/98 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.