Sequence 1: | NP_476935.1 | Gene: | Rbp4 / 41668 | FlyBaseID: | FBgn0010258 | Length: | 428 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997752.2 | Gene: | hnrnpaba / 321466 | ZFINID: | ZDB-GENE-030131-185 | Length: | 340 | Species: | Danio rerio |
Alignment Length: | 219 | Identity: | 65/219 - (29%) |
---|---|---|---|
Similarity: | 106/219 - (48%) | Gaps: | 28/219 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 GNCASSACLGDCKGDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPV 68
Fly 69 SNHSRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFM 133
Fly 134 NSKRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRK 198
Fly 199 HWILQT--------LVEVKRSTQK 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rbp4 | NP_476935.1 | RRM_SF | 33..110 | CDD:302621 | 29/76 (38%) |
RRM2_hnRNPA_like | 137..209 | CDD:240774 | 25/79 (32%) | ||
hnrnpaba | NP_997752.2 | CBFNT | 1..69 | CDD:285369 | 8/27 (30%) |
RRM1_hnRNPAB | 70..144 | CDD:241201 | 28/73 (38%) | ||
RRM2_hnRNPAB | 149..228 | CDD:241028 | 24/98 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1202220at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |