DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and HNRNPA2B1

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_112533.1 Gene:HNRNPA2B1 / 3181 HGNCID:5033 Length:353 Species:Homo sapiens


Alignment Length:397 Identity:107/397 - (26%)
Similarity:169/397 - (42%) Gaps:81/397 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEI 88
            |:...|..||:||||||.:||.|:||.::.|:|.:.|.||:|||.|..||||||||:.....|:.
Human    13 KKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDA 77

  Fly    89 VQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVR 153
            ...||||:||.::||.|.|:.|::..:.|...:|             |::|:||:||..:|:.:|
Human    78 AMAARPHSIDGRVVEPKRAVAREESGKPGAHVTV-------------KKLFVGGIKEDTEEHHLR 129

  Fly   154 EYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWI------------LQTLV 206
            :||.::|.:.:::::.||::|::|.|||:.|.|....:|.:..:.|.|            .|.:.
Human   130 DYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQ 194

  Fly   207 EVKRSTQKADRRFRFPIFSSVRAGYIPPQPAT-----ADSYNYNNPNYNPYLAQSVLPPSAFTNG 266
            ||:.|.......|.|. .|....|...|.|.:     :|.|....               .|.:|
Human   195 EVQSSRSGRGGNFGFG-DSRGGGGNFGPGPGSNFRGGSDGYGSGR---------------GFGDG 243

  Fly   267 WAHYVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHGPDMWSSYPKTG--------IYSAQEWTSS 323
            :..|      ...||.......|..........|.||    .|...|        .|....:.|.
Human   244 YNGY------GGGPGGGNFGGSPGYGGGRGGYGGGGP----GYGNQGGGYGGGYDNYGGGNYGSG 298

  Fly   324 KVAEWGPKAGHKHAQTSTNDRAKIDLKELQAATFNNKLDFGARGDADRMSGAGLGLGLTGGAAVG 388
            ...::|     .:.|..:|      ...:::..|.     |:|.......|...|.|.:||:. |
Human   299 NYNDFG-----NYNQQPSN------YGPMKSGNFG-----GSRNMGGPYGGGNYGPGGSGGSG-G 346

  Fly   389 VGAIKKW 395
            .|...::
Human   347 YGGRSRY 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 40/76 (53%)
RRM2_hnRNPA_like 137..209 CDD:240774 24/83 (29%)
HNRNPA2B1NP_112533.1 Nuclear localization signal. /evidence=ECO:0000255 9..15 1/1 (100%)
RRM1_hnRNPA2B1 19..99 CDD:410155 41/79 (52%)
RRM2_hnRNPA2B1 112..191 CDD:409995 23/78 (29%)
Disordered. /evidence=ECO:0000269|PubMed:26544936 193..353 37/202 (18%)
HnRNPA1 302..326 CDD:402981 5/39 (13%)
Nuclear targeting sequence. /evidence=ECO:0000250 308..347 10/50 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA81
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.