DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and ssx

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster


Alignment Length:410 Identity:79/410 - (19%)
Similarity:150/410 - (36%) Gaps:107/410 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DCKGDGKTAIKEEGYEHLRK-----IFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSR 73
            |.:|:..:|.:::..:.:.:     :.|..|....|...|...||..|.:....::||..:.:|.
  Fly    70 DNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSF 134

  Fly    74 GFGFVTY-VDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKR 137
            |:|||.| .:..|.:.:|:.....:.||.::..:|.|       ||..            :....
  Fly   135 GYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYARP-------GGQS------------IKDTN 180

  Fly   138 IFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKH--- 199
            :::..|....:::::...||.:|.:....:|.|:.|||.|...|:.:.....|::|:....:   
  Fly   181 LYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVP 245

  Fly   200 -------WILQTLVEVKRSTQKADRRFRFPI-FSSVRAGYIPPQ---------PATADSYNYNNP 247
                   |:  .|.|.....:.|  :|...| ..:...|..||.         |...:::::|| 
  Fly   246 EGGSQPIWV--RLAEEHGKAKAA--QFMAQIGGGNGGGGGGPPHMGPGGPMHPPHHHNNHHHNN- 305

  Fly   248 NYNPYLAQSVLPPSAFTNGWAHYVIPMAPKPTPG-----QNMAASLPSQQLAEHSLNGHGPDMWS 307
            ::||:     :||        |:..|..|...|.     .:|....|:.....|..|.|..:..:
  Fly   306 HHNPH-----MPP--------HHHQPQHPHQHPQHHPQLHHMQHHHPNNHNNNHPNNHHHNNNNN 357

  Fly   308 SYPKTGIYSAQEWTSSKVAEWGPKAGHKHAQTSTNDRAKIDLKELQAATFNNKLDFGARGDADRM 372
            ::...|               ||   |.|           .::::.....|  :..|..      
  Fly   358 NHHNMG---------------GP---HPH-----------HMQQMHPMGMN--MGMGVN------ 385

  Fly   373 SGAGLGLGLT--GGAAVGVG 390
            .|.|:|:|:.  ||...|.|
  Fly   386 MGMGMGMGMPIHGGGGGGGG 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 20/82 (24%)
RRM2_hnRNPA_like 137..209 CDD:240774 16/81 (20%)
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 21/86 (24%)
RRM_SF 179..257 CDD:302621 14/79 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.