DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and Hnrnpdl

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_006250724.1 Gene:Hnrnpdl / 305178 RGDID:1309950 Length:419 Species:Rattus norvegicus


Alignment Length:318 Identity:82/318 - (25%)
Similarity:126/318 - (39%) Gaps:78/318 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTI 97
            |:||||||..|:.:.|..:.|:||.|.|..:..|||:..|||||||.:.|..||:.|...:.|.:
  Rat   149 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKL 213

  Fly    98 DNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFGPV 162
            |.|:::.|.|...:                   |....|::|:|||.....|..::|||..||.:
  Rat   214 DGKLIDPKRAKALK-------------------GKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEI 259

  Fly   163 ASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVK--------RSTQKADRRF 219
            .:::|.||.:|..:|.|.|:.:.|....:|.|..|.|.|.....|:|        |..|:..:..
  Rat   260 ENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGG 324

  Fly   220 RFPIFSSVRAGYIPPQPATADSYNYNNPNYNPYLAQSVLPPSAFTNGWAHYVIPMAPKPTPGQNM 284
            | ...:..|.|..........::|....||             :..|:.:|              
  Rat   325 R-GAAAGGRGGARGRGRGQGQNWNQGFNNY-------------YDQGYGNY-------------- 361

  Fly   285 AASLPSQQLAEHSLNGHGPDMWSSYPKTGI-------------YSAQEWTSSKVAEWG 329
                 :....:.|.:|:|     .|..||.             ||.|:.|..|.:..|
  Rat   362 -----NSAYGDESYSGYG-----GYDYTGYNYGSYGYGQGYTDYSGQQSTYGKASRGG 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 33/76 (43%)
RRM2_hnRNPA_like 137..209 CDD:240774 24/71 (34%)
HnrnpdlXP_006250724.1 RRM1_hnRPDL 149..224 CDD:410152 32/74 (43%)
RRM2_hnRPDL 234..308 CDD:409998 25/73 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.