DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Rbp4 and TRA2A

DIOPT Version :9

Sequence 1:	NP_476935.1	Gene:	Rbp4 / 41668	FlyBaseID:	FBgn0010258	Length:	428	Species:	Drosophila melanogaster
Sequence 2:	NP_037425.1	Gene:	TRA2A / 29896	HGNCID:	16645	Length:	282	Species:	Homo sapiens

Alignment Length:	135	Identity:	41/135 - (30%)
Similarity:	57/135 - (42%)	Gaps:	30/135 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly    38 GLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTY--VDPKSVEIVQRARPHTIDNK 100
            |||..||...||..||::|.::...|:.|..:..||||.||.:  :| .|.|.::||....:|.:
Human   125 GLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERID-DSKEAMERANGMELDGR 188

  Fly   101 IVE-----TKHA--------LPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLK--EYHDEN 150
            .:.     ||.|        :.|.....|||.|   |..|...|         ||.:  .|:|..
Human   189 RIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGG---GGGGGGGG---------GGRRRDSYYDRG 241

  Fly   151 IVREY 155
            ..|.|
Human   242 YDRGY 246

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Rbp4	NP_476935.1	RRM_SF	33..110	CDD:302621	27/86 (31%)
Rbp4	NP_476935.1	RRM2_hnRNPA_like	137..209	CDD:240774	6/21 (29%)
TRA2A	NP_037425.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..118
		RRM_TRA2	118..197	CDD:409798	24/72 (33%)
		Linker	198..225		8/29 (28%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	201..245		12/55 (22%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	260..282
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910