DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and Hnrnpa1

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_006242446.1 Gene:Hnrnpa1 / 29578 RGDID:69234 Length:373 Species:Rattus norvegicus


Alignment Length:188 Identity:74/188 - (39%)
Similarity:115/188 - (61%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRAR 93
            |.|||:||||||.:||.|:||..|.|:|.:.|.||:|||.:..|||||||||...:.|:....||
  Rat    11 EQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNAR 75

  Fly    94 PHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQ 158
            ||.:|.::||.|.|:.|:|.:|.|             ..:..|:||:||:||..:|:.:|:||.|
  Rat    76 PHKVDGRVVEPKRAVSREDSQRPG-------------AHLTVKKIFVGGIKEDTEEHHLRDYFEQ 127

  Fly   159 FGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKAD 216
            :|.:..::::.||.:|::|.|.|:.|.|..|.:|.:..:.|.:.....||:::..|.:
  Rat   128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 40/76 (53%)
RRM2_hnRNPA_like 137..209 CDD:240774 24/71 (34%)
Hnrnpa1XP_006242446.1 RRM1_hnRNPA1 12..92 CDD:410154 42/79 (53%)
RRM2_hnRNPA3 105..184 CDD:409996 26/78 (33%)
HnRNPA1 308..345 CDD:402981
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA81
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.