DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and SPBC4F6.14

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_596114.1 Gene:SPBC4F6.14 / 2540871 PomBaseID:SPBC4F6.14 Length:674 Species:Schizosaccharomyces pombe


Alignment Length:174 Identity:48/174 - (27%)
Similarity:79/174 - (45%) Gaps:28/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRA----RP 94
            :|:..|:.||..:.|..|||..|.:..|||:.:|.:..:||:||||:   ..:|..|||    :.
pombe     7 LFVRNLAFQTKQDDLTNFFSDVGPIKHAVVVTNPETGENRGYGFVTF---SMLEDAQRAAKELKN 68

  Fly    95 HTIDNKIVETKHALPRQ----DFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGL-----KEYHDEN 150
            ..:..:|:....|.||:    |..:...|...:..       .|..|:.:..|     |..|   
pombe    69 KKLHGRILRLDFATPR
KRSEVDTDQNKAVKKTIRQ-------DNRPRLIIRNLPWSIKKPQH--- 123

  Fly   151 IVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKAL 194
             :..:||:||.|..:| :..:..||...|.|:...|..:||:|:
pombe   124 -LEPHFSKFGKVREIK-IPTKGGGRMCGFAFVWMKDRKAAEEAM 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 25/79 (32%)
RRM2_hnRNPA_like 137..209 CDD:240774 18/63 (29%)
SPBC4F6.14NP_596114.1 RRM1_Nop4p 6..84 CDD:241118 25/79 (32%)
RRM2_Nop4p 107..189 CDD:241119 18/64 (28%)
RRM3_RBM28_like 278..384 CDD:240861
RRM4_Nop4p 458..614 CDD:241121
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.