DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and PUF60

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001349824.1 Gene:PUF60 / 22827 HGNCID:17042 Length:596 Species:Homo sapiens


Alignment Length:223 Identity:47/223 - (21%)
Similarity:90/223 - (40%) Gaps:43/223 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEI--------- 88
            ::::|.:..:...:|:|..|:.||.:....:..|.|:...:||.||.|..|::.::         
Human   167 RVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVM 231

  Fly    89 -----VQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHD 148
                 ::..||..|                   |....::.....||...|  ||::..:.:...
Human   232 LGGRNIKVGRPSNI-------------------GQAQPIIDQLAEEARAFN--RIYVASVHQDLS 275

  Fly   149 ENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWIL--QTLVEVKRS 211
            ::.::..|..||.:.|..|..|..||:.:.:||:|:....|::.|::....:.|  |.|...|..
Human   276 DDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAV 340

  Fly   212 TQKADRRFRFPIFSSVRAGYIPPQPATA 239
            |..      .|:.:....|.:||..|.|
Human   341 TPP------MPLLTPATPGGLPPAAAVA 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 17/90 (19%)
RRM2_hnRNPA_like 137..209 CDD:240774 18/73 (25%)
PUF60NP_001349824.1 half-pint 44..596 CDD:130706 47/223 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.