Sequence 1: | NP_476935.1 | Gene: | Rbp4 / 41668 | FlyBaseID: | FBgn0010258 | Length: | 428 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001317178.1 | Gene: | HNRNPA3 / 220988 | HGNCID: | 24941 | Length: | 378 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 74/197 - (37%) |
---|---|---|---|
Similarity: | 119/197 - (60%) | Gaps: | 18/197 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 EEGY-----EHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPK 84
Fly 85 SVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDE 149
Fly 150 NIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQK 214
Fly 215 AD 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rbp4 | NP_476935.1 | RRM_SF | 33..110 | CDD:302621 | 38/76 (50%) |
RRM2_hnRNPA_like | 137..209 | CDD:240774 | 23/71 (32%) | ||
HNRNPA3 | NP_001317178.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..35 | 4/11 (36%) | |
RRM1_hnRNPA_like | 36..113 | CDD:409992 | 38/76 (50%) | ||
RRM2_hnRNPA3 | 126..205 | CDD:409996 | 26/78 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 204..225 | 1/3 (33%) | |||
HnRNPA1 | 331..>347 | CDD:402981 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 336..378 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E33208_3BA81 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1202220at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.780 |