DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and ELAVL1

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001410.2 Gene:ELAVL1 / 1994 HGNCID:3312 Length:326 Species:Homo sapiens


Alignment Length:265 Identity:64/265 - (24%)
Similarity:102/265 - (38%) Gaps:71/265 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DCKGD-GKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGF 77
            ||:|| |:|           .:.:..|....|.:.||..||..|.|..|.::||.|:.||.|:||
Human    12 DCRGDIGRT-----------NLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGF 65

  Fly    78 VTYVDPKSVE-IVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLG 141
            |.||..|..| .:.......:.:|.::..:|.|..:                   .:....:::.
Human    66 VNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSE-------------------VIKDANLYIS 111

  Fly   142 GLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLV 206
            ||.....:..|.:.||:||.:.:.::|:|:.||..|...|:.|...|.||:|:..          
Human   112 GLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITS---------- 166

  Fly   207 EVKRSTQKADRRFRFPIFSSVRAGYIPP---QPATADSYNYNNPNYN---PYLAQSVLPPSAFTN 265
                             |:    |:.||   :|.|...  ..|||.|   ..|:|....|:....
Human   167 -----------------FN----GHKPPGSSEPITVKF--AANPNQNKNVALLSQLYHSPARRFG 208

  Fly   266 GWAHY 270
            |..|:
Human   209 GPVHH 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 24/77 (31%)
RRM2_hnRNPA_like 137..209 CDD:240774 18/71 (25%)
ELAVL1NP_001410.2 ELAV_HUD_SF 19..326 CDD:273741 59/258 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.