DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and rnp-9

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001359585.1 Gene:rnp-9 / 182350 WormBaseID:WBGene00007396 Length:312 Species:Caenorhabditis elegans


Alignment Length:166 Identity:39/166 - (23%)
Similarity:82/166 - (49%) Gaps:18/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVE-IVQRARPHTI 97
            :|:|.||...:.|.|:..|::||.|::|.|:||..:..|:|:|||::.:.::.| .:.......|
 Worm    89 VFVGDLSKDVSNELLKSTFTKFGEVSEAKVIRDVQTQKSKGYGFVSFPNKQNAENAIAGMNGKWI 153

  Fly    98 DNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSK----RIFLGGLKEYHDENIVREYFSQ 158
            ..:.|.|..|..:...:....:     :|  |..|.::|    .:::|.:.:...:..:|:.||.
 Worm   154 GKRAVRTNW
AARKNSEENRDKL-----TF--EQVFNSTKADNTSVYVGNISQQTTDADLRDLFST 211

  Fly   159 FGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKAL 194
            :|.:|.|::.      :.:.:.|:.:.....|.||:
 Worm   212 YGDIAEVRIF------KTQRYAFVRYEKKECATKAI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 24/76 (32%)
RRM2_hnRNPA_like 137..209 CDD:240774 11/58 (19%)
rnp-9NP_001359585.1 RRM2_TIA1_like 88..162 CDD:240799 23/72 (32%)
RRM3_TIA1_like 189..260 CDD:240800 11/59 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.