Sequence 1: | NP_476935.1 | Gene: | Rbp4 / 41668 | FlyBaseID: | FBgn0010258 | Length: | 428 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_741783.1 | Gene: | hrpa-2 / 180791 | WormBaseID: | WBGene00019249 | Length: | 336 | Species: | Caenorhabditis elegans |
Alignment Length: | 202 | Identity: | 72/202 - (35%) |
---|---|---|---|
Similarity: | 108/202 - (53%) | Gaps: | 35/202 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 YEH-----LRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVE 87
Fly 88 IVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVV--------GSFGCEAGFMNSKRIFLGGLK 144
Fly 145 E-YHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPR--KHWILQTLV 206
Fly 207 EVKRSTQ 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rbp4 | NP_476935.1 | RRM_SF | 33..110 | CDD:302621 | 40/76 (53%) |
RRM2_hnRNPA_like | 137..209 | CDD:240774 | 21/74 (28%) | ||
hrpa-2 | NP_741783.1 | RRM | <62..230 | CDD:223796 | 67/186 (36%) |
RRM1_hnRNPA_like | 71..148 | CDD:241022 | 40/76 (53%) | ||
RRM_SF | 183..240 | CDD:302621 | 19/61 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |