DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and hrpa-2

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_741783.1 Gene:hrpa-2 / 180791 WormBaseID:WBGene00019249 Length:336 Species:Caenorhabditis elegans


Alignment Length:202 Identity:72/202 - (35%)
Similarity:108/202 - (53%) Gaps:35/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YEH-----LRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVE 87
            |:|     |||:||||||..||.|.|..:|||:|.|.||:|:|||.:.|||||||||:....|.|
 Worm    61 YQHDSPPQLRKLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAE 125

  Fly    88 IVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVV--------GSFGCEAGFMNSKRIFLGGLK 144
            .....|||.:..|.|::|.|:||:.      :.|::        .:.||        ::.|.|:.
 Worm   126 SAMNDRPHKLGGKTVDSKRAIPREQ------MSSMIPPPFFETDPAPGC--------KLLLNGIT 176

  Fly   145 E-YHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPR--KHWILQTLV 206
            . .|..:.:|.||..||.:..|::|     |:.|..||:.:.|..||::.||..  :|.:.:..:
 Worm   177 NGVHSVDSLRVYFETFGTLDQVEIL-----GQPRGLGFVIYEDKESADRCLAHNSGRHIVNERKI 236

  Fly   207 EVKRSTQ 213
            ||:..|:
 Worm   237 EVRVFTK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 40/76 (53%)
RRM2_hnRNPA_like 137..209 CDD:240774 21/74 (28%)
hrpa-2NP_741783.1 RRM <62..230 CDD:223796 67/186 (36%)
RRM1_hnRNPA_like 71..148 CDD:241022 40/76 (53%)
RRM_SF 183..240 CDD:302621 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.