DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and hrpa-1

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001040945.1 Gene:hrpa-1 / 177101 WormBaseID:WBGene00001999 Length:347 Species:Caenorhabditis elegans


Alignment Length:198 Identity:70/198 - (35%)
Similarity:119/198 - (60%) Gaps:16/198 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYV 81
            |.|..:::.   |:|||||:|||::.||.:.:|.|:||||.:.|.:|:|||.:..||||||||:.
 Worm    11 GSGDASLEP---ENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFS 72

  Fly    82 DPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEY 146
            ....|:...:.|||.||.|.|:.|.|:||.|..|.            |:. :::||:::.|::|.
 Worm    73 GKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRS------------ESN-VSTKRLYVSGVRED 124

  Fly   147 HDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRS 211
            |.|:::.|||:::|.|...::::|:.|.:.|.|||:.|.|..|.::.:..:.|.:.....:|::.
 Worm   125 HTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKG 189

  Fly   212 TQK 214
            ..|
 Worm   190 LSK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 37/76 (49%)
RRM2_hnRNPA_like 137..209 CDD:240774 20/71 (28%)
hrpa-1NP_001040945.1 RRM1_hnRNPA_like 24..101 CDD:241022 37/76 (49%)
RRM2_hnRNPA_like 115..187 CDD:240774 20/71 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.