DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and msi-1

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001369851.1 Gene:msi-1 / 175514 WormBaseID:WBGene00003423 Length:320 Species:Caenorhabditis elegans


Alignment Length:296 Identity:91/296 - (30%)
Similarity:144/296 - (48%) Gaps:44/296 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVD 82
            ||....::.|     |:||||||.|||.|.||.:|.:||.|.:.:|:|||.:..:|||||:|:||
 Worm    36 DGSHGSQDPG-----KMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVD 95

  Fly    83 PKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFM-NSKRIFLGGLKEY 146
            |.||:.|...|.|.:|.|.::.|.|.|::                .:|..: .:|::|:|||...
 Worm    96 PSSVDKVLNNREHELDGKKIDPKVAFPKR----------------TQAKLVTKTKKVFIGGLSAT 144

  Fly   147 HDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRS 211
            .....:::||..:|.|....|:.|:.|.|.|.|||:.|.....|:|......|.|...:||.|::
 Worm   145 STLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKA 209

  Fly   212 TQKADRRFRFPI------FSSVRAGY-IPPQPATADSYNYNNPNYNPYLAQSVLPPSAFTNGWAH 269
            ..|   ....|:      .::.|..| :||:...|.:      .|.|....:::.|: |||.:.:
 Worm   210 QPK---EVMLPVQLNKSRAAAARNLYGMPPETLLAYA------QYLPRFGGNLMYPN-FTNVFNN 264

  Fly   270 YVIPMAPKPTPGQNMAASLPSQQL---AEHSLNGHG 302
            .....:...|||.  :::.|..|.   :.:|||..|
 Worm   265 MPGGYSGLSTPGG--SSNRPPHQFDTASLYSLNNGG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 39/76 (51%)
RRM2_hnRNPA_like 137..209 CDD:240774 23/71 (32%)
msi-1NP_001369851.1 RRM1_MSI 46..121 CDD:409990 38/74 (51%)
RRM2_MSI 135..208 CDD:240769 23/72 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.