DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and Hnrnpa1

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001034218.1 Gene:Hnrnpa1 / 15382 MGIID:104820 Length:373 Species:Mus musculus


Alignment Length:188 Identity:74/188 - (39%)
Similarity:115/188 - (61%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRAR 93
            |.|||:||||||.:||.|:||..|.|:|.:.|.||:|||.:..|||||||||...:.|:....||
Mouse    11 EQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNAR 75

  Fly    94 PHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQ 158
            ||.:|.::||.|.|:.|:|.:|.|             ..:..|:||:||:||..:|:.:|:||.|
Mouse    76 PHKVDGRVVEPKRAVSREDSQRPG-------------AHLTVKKIFVGGIKEDTEEHHLRDYFEQ 127

  Fly   159 FGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKAD 216
            :|.:..::::.||.:|::|.|.|:.|.|..|.:|.:..:.|.:.....||:::..|.:
Mouse   128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 40/76 (53%)
RRM2_hnRNPA_like 137..209 CDD:240774 24/71 (34%)
Hnrnpa1NP_001034218.1 RRM1_hnRNPA1 12..92 CDD:241205 42/79 (53%)
RRM2_hnRNPA1 105..181 CDD:241024 26/75 (35%)
HnRNPA1 310..345 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA81
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.