Sequence 1: | NP_476935.1 | Gene: | Rbp4 / 41668 | FlyBaseID: | FBgn0010258 | Length: | 428 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001011724.1 | Gene: | HNRNPA1L2 / 144983 | HGNCID: | 27067 | Length: | 320 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 75/197 - (38%) |
---|---|---|---|
Similarity: | 118/197 - (59%) | Gaps: | 14/197 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 KTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPK 84
Fly 85 SVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDE 149
Fly 150 NIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQK 214
Fly 215 AD 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rbp4 | NP_476935.1 | RRM_SF | 33..110 | CDD:302621 | 38/76 (50%) |
RRM2_hnRNPA_like | 137..209 | CDD:240774 | 24/71 (34%) | ||
HNRNPA1L2 | NP_001011724.1 | Globular A domain | 4..94 | 44/90 (49%) | |
RRM1_hnRNPA1 | 12..92 | CDD:410154 | 40/79 (51%) | ||
Globular B domain | 95..185 | 29/102 (28%) | |||
RRM_SF | 105..184 | CDD:418427 | 26/78 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 181..216 | 1/5 (20%) | |||
RNA-binding RGG-box | 218..240 | ||||
HnRNPA1 | 255..292 | CDD:402981 | |||
Nuclear targeting sequence. /evidence=ECO:0000250 | 268..305 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 271..320 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E33208_3BA81 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1202220at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |