DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and HNRNPA1L2

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001011724.1 Gene:HNRNPA1L2 / 144983 HGNCID:27067 Length:320 Species:Homo sapiens


Alignment Length:197 Identity:75/197 - (38%)
Similarity:118/197 - (59%) Gaps:14/197 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPK 84
            |:|..:|. |.|||:||||||.:||.|:||..|.|:|.:.|.||:|||.:..|||||||||...:
Human     3 KSASPKEP-EQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVE 66

  Fly    85 SVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDE 149
            .|:......||.:|.::||.|.|:.|:|.:|.|             ..:..|:||:||:||..:|
Human    67 EVDAAMNTTPHKVDGRVVEPKRAVSREDSQRPG-------------AHLTVKKIFVGGIKEDTEE 118

  Fly   150 NIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQK 214
            :.:|:||.|:|.:..::::.||.:|::|.|.|:.|.|..|.:|.:..:.|.:.....||:::..|
Human   119 HHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVKGHNCEVRKALPK 183

  Fly   215 AD 216
            .:
Human   184 QE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 38/76 (50%)
RRM2_hnRNPA_like 137..209 CDD:240774 24/71 (34%)
HNRNPA1L2NP_001011724.1 Globular A domain 4..94 44/90 (49%)
RRM1_hnRNPA1 12..92 CDD:410154 40/79 (51%)
Globular B domain 95..185 29/102 (28%)
RRM_SF 105..184 CDD:418427 26/78 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..216 1/5 (20%)
RNA-binding RGG-box 218..240
HnRNPA1 255..292 CDD:402981
Nuclear targeting sequence. /evidence=ECO:0000250 268..305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA81
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.