DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AgaP_AGAP002335

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_312633.5 Gene:AgaP_AGAP002335 / 1273632 VectorBaseID:AGAP002335 Length:458 Species:Anopheles gambiae


Alignment Length:259 Identity:63/259 - (24%)
Similarity:103/259 - (39%) Gaps:59/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLR----DPVSNHSRGFGFVTYVDPKS 85
            ||.|.  :.:::|.|.|..|.|.|...|||.|.|....::|    ||       |.|:.|.:.:|
Mosquito     3 EESYP--KTLYVGNLDTSVTEELLCTLFSQMGTVKSCKIIRETSIDP-------FAFIEYANHQS 58

  Fly    86 VEIVQRARPHTIDNKIVETKHAL-----------PRQDFKRGGGVGSVVGSFGCEAGFMNSKRIF 139
            .:....|.     ||.:..|..:           |:.|..:                   ...||
Mosquito    59 AQTALAAM-----NKRMFLKKEIRVNWATSAGNQPKTDTSQ-------------------HHHIF 99

  Fly   140 LGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRK-HWILQ 203
            :|.|....|...:||.|:.||.:::.:::.|.:|.:.|.:.|:.||..:.||.|:|... .|:..
Mosquito   100 VGDLSPEIDTETLREAFAPFGEISNCRIVRDPQTLKSRGYAFVSFVKKAEAENAIAMMNGQWLGS 164

  Fly   204 TLVEVKRSTQK--ADRRFRFPIFSSVRAGYIPPQPATADSYNYNNPNYNPYLAQSVLPPSAFTN 265
            ..:....||:|  |.|...    ..:::|   ..|...:.||..:|. |..:.....||:|.|:
Mosquito   165 RSIRTNWSTRKPPAPRENS----KGIKSG---KTPGFEEIYNNTSPT-NTTVYCGGFPPNAITD 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 22/91 (24%)
RRM2_hnRNPA_like 137..209 CDD:240774 21/72 (29%)
AgaP_AGAP002335XP_312633.5 RRM1_TIA1_like 10..81 CDD:240798 22/82 (27%)
RRM2_TIA1_like 97..171 CDD:240799 21/73 (29%)
RRM3_TIA1_like 206..279 CDD:240800 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.