DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and AgaP_AGAP003899

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_560351.3 Gene:AgaP_AGAP003899 / 1269490 VectorBaseID:AGAP003899 Length:302 Species:Anopheles gambiae


Alignment Length:204 Identity:43/204 - (21%)
Similarity:81/204 - (39%) Gaps:32/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IFIGGLSTQTTVETLRGFFSQFGIVADAVVLRD-PVSNHSRGFGFVTYVDPKSVEIVQRA----R 93
            :.:..|....|...:...||..|.:....::|| ..:.:|.|||||.|::.   |..|||    .
Mosquito   106 LIVNYLPQDMTEREMYSMFSAMGPIESCRLMRDLKQTGYSYGFGFVNYLNE---EAAQRAIKCLN 167

  Fly    94 PHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQ 158
            .:.:.||.::..:|.|:.|                   .:....:::..|.....|..:...|.:
Mosquito   168 GYPLRNKRLKVSYARPQS
D-------------------DIKETNLYITNLPRTITEEQLDIIFGK 213

  Fly   159 FGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQ-----TLVEVKRSTQKADRR 218
            :|.:....:|.|:.||:.|...|:.|.....|::|::...:.|.|     .:|.|.....:|...
Mosquito   214 YGTIVQKNILRDKLTGQPRGVAFVRFNKREEAQEAISALNNVIPQGGNQPLIVRVAEDHGRAKAA 278

  Fly   219 FRFPIFSSV 227
            ...|.::|:
Mosquito   279 LYVPSYNSI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 21/80 (26%)
RRM2_hnRNPA_like 137..209 CDD:240774 16/76 (21%)
AgaP_AGAP003899XP_560351.3 RRM_SF 104..185 CDD:302621 22/81 (27%)
RRM_SF 191..269 CDD:302621 16/77 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.