DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and Hnrnpd

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001070733.1 Gene:Hnrnpd / 11991 MGIID:101947 Length:355 Species:Mus musculus


Alignment Length:356 Identity:95/356 - (26%)
Similarity:152/356 - (42%) Gaps:81/356 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GNCASSACLGDCKGDGKTAIKEEGYEHLR--------------KIFIGGLSTQTTVETLRGFFSQ 54
            |....||.....|.|.....::||:.:..              |:||||||..||.:.|:.:||:
Mouse    55 GTEGGSAEAEGAKIDASKNEEDEGHSNSSPRHTEAAAAQREEWKMFIGGLSWDTTKKDLKDYFSK 119

  Fly    55 FGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGV 119
            ||.|.|..:..||::..|||||||.:.:.:||:.|...:.|.::.|:::.|.|   :..|....|
Mouse   120 FGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA---KAMKTKEPV 181

  Fly   120 GSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEF 184
                            |:||:|||.....|..:||||..||.|.|::|.||.:|.::|.|.|:.|
Mouse   182 ----------------KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITF 230

  Fly   185 VDPSSAEKALAPRKHWILQTLVEVK--------RSTQKADRRFRFPIFSSVRAGYIPPQPATADS 241
            .:....:|.:..:.|.:..:..|:|        :..|:...|..|...:..|.|        ..|
Mouse   231 KEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGG--------GPS 287

  Fly   242 YNYNNPNYNPYLAQSVLPPSAFTNGWAHYVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHGPDMW 306
            .|:|. .|:.|          :..|:.:|          |.|      ||....:  .|:....:
Mouse   288 QNWNQ-GYSNY----------WNQGYGNY----------GYN------SQGYGGY--GGYDYTGY 323

  Fly   307 SSYPKTGIYSAQEWTSSKVAEWGPKAGHKHA 337
            ::|...|.||.|:....||:..|   ||:::
Mouse   324 NNYYGYGDYSNQQSGYGKVSRRG---GHQNS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 32/76 (42%)
RRM2_hnRNPA_like 137..209 CDD:240774 25/71 (35%)
HnrnpdNP_001070733.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 7/35 (20%)
CBFNT <60..78 CDD:311868 4/17 (24%)
RRM1_hnRNPD_like 99..172 CDD:241019 30/72 (42%)
RRM2_hnRNPD 183..257 CDD:241027 26/73 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.