DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and HNRNPA0

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_006796.1 Gene:HNRNPA0 / 10949 HGNCID:5030 Length:305 Species:Homo sapiens


Alignment Length:186 Identity:72/186 - (38%)
Similarity:105/186 - (56%) Gaps:13/186 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPH 95
            |.|:|||||:.||:...|||.|..||.:.|.||:.:|.:..||.||||||.:.:..:....|.||
Human     6 LCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPH 70

  Fly    96 TIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFG 160
            .:|...||.|.|:.|:|..|.|....|             |::|:||||....|..:.|:|||||
Human    71 AVDGNTVELKRAVSREDSARPGAHAKV-------------KKLFVGGLKGDVAEGDLIEHFSQFG 122

  Fly   161 PVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKAD 216
            .|...:::.|:::|::|.|||:.|.:..:|:||...:.|.|....||||::..|.|
Human   123 TVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKED 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 34/76 (45%)
RRM2_hnRNPA_like 137..209 CDD:240774 27/71 (38%)
HNRNPA0NP_006796.1 RRM1_hnRNPA0 5..83 CDD:240772 34/76 (45%)
RRM2_hnRNPA0 99..178 CDD:241023 30/78 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..214 2/5 (40%)
HnRNPA1 255..>269 CDD:314495
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..305
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.